PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.025370.1
Common NameCsa_7G395250, LOC101204763
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family NF-YB
Protein Properties Length: 152aa    MW: 16592.3 Da    PI: 4.8821
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.025370.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB170.71.7e-5345141197
           NF-YB   1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 
                     v+eqdr+lPianv+rimk++lP nakisk+aket+qecvsefisfvt+easdkc++ekrkt+ngdd++ alatlGf+dy+epl+ yl +yr++eg
  Cucsa.025370.1  45 VKEQDRLLPIANVGRIMKQILPPNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTVNGDDICCALATLGFDDYAEPLRRYLVRYRDMEG 139
                     58********************************************************************************************* PP

           NF-YB  96 ek 97 
                     e+
  Cucsa.025370.1 140 ER 141
                     97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.103.5E-5044146IPR009072Histone-fold
SuperFamilySSF471136.52E-3848146IPR009072Histone-fold
PfamPF008081.3E-2751115IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.0E-177997No hitNo description
PROSITE patternPS0068508298IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.0E-1798116No hitNo description
PRINTSPR006151.0E-17117135No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 152 aa     Download sequence    Send to blast
MDENTGMPER SIEFKYDFTG GGSSGVGGST GGSSEEAGYG VGGVVKEQDR LLPIANVGRI  60
MKQILPPNAK ISKEAKETMQ ECVSEFISFV TGEASDKCHK EKRKTVNGDD ICCALATLGF  120
DDYAEPLRRY LVRYRDMEGE RAQQNKGCCN NX
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B7e-4445136192Transcription factor HapC (Eurofung)
4g92_B7e-4445136192Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818030.0LN681803.1 Cucumis melo genomic scaffold, anchoredscaffold00026.
GenBankLN7132550.0LN713255.1 Cucumis melo genomic chromosome, chr_1.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008451614.11e-108PREDICTED: nuclear transcription factor Y subunit B-1
RefseqXP_011659350.11e-108PREDICTED: nuclear transcription factor Y subunit B-5
SwissprotO822482e-58NFYB5_ARATH; Nuclear transcription factor Y subunit B-5
TrEMBLA0A0A0K9541e-108A0A0A0K954_CUCSA; Uncharacterized protein
STRINGGLYMA10G02480.16e-69(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF80532131
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47810.15e-59nuclear factor Y, subunit B5
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]